PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc10_g07580
Common NameGSCOC_T00034503001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family bZIP
Protein Properties Length: 160aa    MW: 18268.7 Da    PI: 8.9011
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc10_g07580genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1408.6e-1370126561
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                  ++ rr+++NR +ArrsR+RKk+++eeL++ + +L+ eN++Lk++l   + ++ ++++
  Cc10_g07580  70 RKRRRMISNRDSARRSRLRKKKQLEELTNQMNQLKLENTELKNQLCLVSHQYRAVQM 126
                  6789**************************************999888888776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.3E-1366130IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-1067121No hitNo description
PROSITE profilePS5021711.12868131IPR004827Basic-leucine zipper domain
PfamPF001704.3E-1070120IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.13E-1170121No hitNo description
CDDcd147024.31E-1871122No hitNo description
PROSITE patternPS0003607388IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MSCEEPVHFH FPPVLEDPFT CSDLHDLVSL IQSGFPTHAN SGSETTRNGM PSNSTSGSET  60
NRSVYSVEER KRRRMISNRD SARRSRLRKK KQLEELTNQM NQLKLENTEL KNQLCLVSHQ  120
YRAVQMDSTR LMAESIDLRQ KLANLNQILV NMQLPSSLH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16973RKRRR
27190RRRMISNRDSARRSRLRKKK
38288RRSRLRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074583.15e-43PREDICTED: basic leucine zipper 43-like
TrEMBLA0A068U0731e-115A0A068U073_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000125753e-38(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28202251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.18e-22basic leucine-zipper 5